Gå rakt till innehåll Gå rakt till sidfoten

Placeringsportföljer med omfattande diversifiering

Letar du efter sätt att diversifiera dina placeringar effektivt i olika tillgångsklasser? Vill du placera i samma objekt storinvesterare placerar i, till exempel i fastigheter och kapitalplaceringsobjekt?

Bekanta dig med våra placeringsportföljer med omfattande diversifiering som tagits fram med hjälp av LokalTapiolas placeringsexpertis.

Omfattande diversifiering och samma förmåner som stora investerare har

Placeringsportföljer med omfattande diversifiering möjliggör lätt och smidigt placerande för dig som uppskattar en omfattande diversifiering i olika tillgångsklasser och långsiktigt placerande. Du kan placera i portföljer med omfattande diversifiering via LokalTapiolas Placeringsförsäkring.

Med placeringsportföljer som har omfattande diversifiering får du tillgång till ett stort utbud placeringsobjekt som ofta endast storinvesterare har tillgång till. Med en omfattande diversifiering strävar vi efter att uppnå ett optimalt förhållande mellan avkastning och risk och vi placerar dina tillgångar i objekt vi själva placerar i. Du har även nytta av prissättningen som erbjuds oss i rollen av storinvesterare.

Hur kan jag börja placera?

Ge dina kontaktuppgifter i formuläret bredvid så kontaktar vi dig snarast möjligt. Låt oss tillsammans fundera på vilket sätt att placera är bäst för dig.

En placeringsförsäkring kan skräddarsys för just dig. Vi kartlägger vilken typ av placerare du är, hur stor avkastning du eftersträvar och hur stor risk du är beredd att ta. Utifrån det tar vi fram en lösning som lämpar sig bäst för dig.

Du kan även boka tid till ett möte.

Blev du intresserad?


I vilka objekt placerar portföljerna med omfattande diversifiering?

Vi hjälper dig att av tre olika alternativ välja en portfölj som motsvarar ditt placeringsmål och din risktolerans. Du kan välja ett placeringsobjekt som passar din situation bland tre olika portföljer med olika risknivåer: Omfattande Måttlig, Omfattande Jämvikt och Omfattande Modig. Hur stor andel portföljerna placerar i aktier, räntor, fastigheter och kapitalplaceringsobjekt varierar beroende på risknivå.

När du valt en portfölj enligt önskad risknivå tar en kapitalförvaltningsexpert på dina vägnar beslut om placeringsobjekten och hur ditt sparbelopp allokeras med beaktande av de avtalade gränserna.

Mer om tillgångsklasserna

Aktieplaceringarna gör vi i regel i aktier i börsbolag eller i aktiebundna instrument. Med hjälp av fonder utvidgar vi diversifieringen geografiskt och lägger vikt vid olika teman och stilar.

Vi placerar globalt i olika räntetillgångsklasser såsom penningmarknadsplaceringar, statsobligationer, företagsobligationer och obligationer på tillväxtmarknaderna.

Fastighetsplaceringarna gör vi i huvudsak i bostäder, lokaler, fastighetskapitalfonder, fastighetsfonder eller aktier eller andelar i bolag vilka bedriver fastighetsplaceringsverksamhet och vilka finns i Finland.

Kapitalplaceringarna gör vi i kapitalfonder vilka placerar i aktier i onoterade bolag eller sådana bolags lånebaserade finansiering med hög risk.


Så här drar du nytta av LokalTapiolas placeringsportföljer med omfattande diversifiering

Vi är en av Finlands mest erfarna kapitalförvaltare. Placeringar har alltid varit en viktig del av vår försäkringsverksamhet och så länge LokalTapiola har sysslat med försäkringar, så har vi även placerat. Som kund i ett ömsesidigt bolag är du en av våra ägare och vi vill att du ska ha nytta av vår erfarenhet och våra kunskaper. Vi erbjuder professionell, ansvarsfull och hållbar kapitalförvaltning oberoende av placeringsbelopp.

Du kan spara och placera i samma placeringsobjekt vi använder när vi placerar LokalTapiolas tillgångar. Vi förvaltar även dina tillgångar lika noggrant, ansvarsfullt och hållbart som LokalTapiolas tillgångar.

Via oss kan du placera i objekt som vanligtvis endast storinvesterare har tillgång till. Som placeringsobjekt används utöver aktier och räntor fastigheter och kapitalplaceringar – precis som när vi placerar försäkringsbolagens tillgångar. Du har även nytta av prissättningen som erbjuds oss i rollen av storinvesterare.

En placerare som placerar ansvarsfullt och hållbart beaktar ESG, det vill säga faktorer i anknytning till miljön, socialt ansvar och en god förvaltningssed, när placeringsbesluten fattas. LokalTapiola Kapitalförvaltning har varit en föregångare i Finland inom ansvarsfullt och hållbart placerande, och har systematiskt utvecklat sina verksamhetsmodeller för att svara på de utmaningar som ESG och en hållbar utveckling samt den ökade kundefterfrågan för med sig.

Vi beaktar din livssituation på ett heltäckande sätt. Utöver omfattande försäkringstjänster erbjuder vi även ekonomiska tjänster. Vi hjälper dig att skapa beredskap med försäkringar, att uppnå framgång med placeringar och att spara för bra och dåliga tider.

Hos oss kan du börja spara med endast 30 euro per månad eller genom att placera en större summa på en gång. När du sparar har du tiden på din sida och med tiden kan redan ett litet sparbelopp per månad vara fruktbart.


Läs mer

Produktfakta och villkor för placeringsförsäkring
Produktfakta
Villkor

Stadgar för placeringsportföljer med omfattande diversifiering

Vilka är totalkostnaderna?
Totalkostnaderna består av den årliga förvaltningsavgiften för försäkringen och kostnader som hänför sig till placeringsobjektet. Nedan finns en uppskattning av de årliga totalkostnaderna.

• Omfattande Måttlig 1,40 %
• Omfattande Jämvikt 1,63 %
• Omfattande Modig 1,78 %

(Uppskattningen utgår från att tillgångarna som placerats i försäkringen är högst 100 000 euro varvid förvaltningsavgiften för försäkringen är 0,5 %. Handelskostnaderna har inte beaktats i totalkostnaderna.)

Den årliga förvaltningsavgiften för försäkringen varierar mellan 0,5 och 0,2 procent beroende på sparbeloppet:
• 0,5 % upp till 100 000 euro
• 0,3 % för belopp som överstiger 100 000 euro
• 0,2 % för belopp som överstiger 2 000 000 euro.

Kostnaderna för placeringsobjektet består av den fasta förvaltningsavgiften för placeringsportföljen och övriga kostnader som hänför sig till placeringsobjekten i placeringsportföljen. Övriga kostnader är förvaringsavgifter, tecknings-, inlösen- och förvaltningsavgift, handelskostnader samt eventuella skatter och andra offentligrättsliga avgifter.

Vad kostar det att ta ut tillgångar från avtalet?
Du kan när som helst under avtalstiden ta ut sparbelopp från ditt avtal. Vid återköp och uttag av sparbelopp som gäller placeringsportföljen eller överföring av sparbelopp från placeringsportföljen till andra placeringsobjekt i försäkringen uppbärs en uttagsavgift på 1 % från beloppet som tas ut eller överförs.
Från och med det tredje uttaget av sparbelopp, debiterar vi en handläggningsavgift på 24,74 euro (år 2021). För uppsägning av avtal debiteras inga avgifter. Beakta dock, att efter ett delvist uttag måste sparbeloppet minst uppgå till 150 €.

De förväntade avkastningarna på placeringsportföljerna med omfattande diversifiering efter totalkostnaderna är:

• Omfattande Måttlig 1,50 %
• Omfattande Jämvikt 2,97 %
• Omfattande Modig 4,12 %

Placeringsförsäkringar och kapitaliseringsavtal erbjuds av  LokalTapiola Ömsesidigt Livförsäkringsbolag och kapitalförvaltning av LokalTapiola Kapitalförvaltning Ab.

LokalTapiola ansvarar inte för utvecklingen av värdet på placeringarna eller för en eventuell värdeminskning. Du bär som försäkringstagare risken för placeringens värdeutveckling och du kan även förlora hela eller delar av det placerade kapitalet. Observera att även om det i placeringsportföljerna finns samma objekt som LokalTapiola använder, så kan avkastningen på den portfölj du valt inte direkt jämföras med LokalTapiolas intäkter av placeringsverksamheten.

De förväntade avkastningarna är uppskattningar som grundar sig på avkastningsutvecklingen på lång sikt. Tidigare avkastning är ingen garanti för framtida avkastning.