<link rel="stylesheet" href="/cs/chat/stylesheets/lahitapiola-chat.css"/>
Gå rakt till innehåll Gå rakt till sidfoten

Placeringsportföljer med omfattande diversifiering

Laajan hajautuksen sijoitussalkut tarjoavat vaivattoman ratkaisun pitkäaikaiseen sijoittamiseen. Laajalla hajautuksella pyritään parhaaseen mahdolliseen tuoton ja riskin suhteeseen. Varat sijoitetaan eri omaisuusluokkiin, kuten kiinteistöihin ja pääomasijoituksiin. Nämä sijoituskohteet ovat usein mahdollisia vain suurille sijoittajille, mutta kauttamme pääset sijoittamaan kohteisiin, joihin itsekin sijoitamme. Lisäksi hyödyt myös saamistamme hinnoittelueduista. Voit sijoittaa salkkuihin LähiTapiolan sijoitusvakuutuksen kautta.

Tillgångsslag som används i portföljerna

Aktier

Vi placerar huvudsakligen i aktier i börsnoterade bolag. Fonderna används för att utöka diversifieringen geografiskt, med tonvikt på olika teman och stilar.

Ränteplaceringar

Vi placerar globalt i olika räntetillgångsslag, såsom penningmarknadsplaceringar, statsobligationer, företagsobligationer och tillväxtmarknadernas lån.

Fastighetsplaceringar

Vi gör fastighetsplaceringar främst i lägenheter, affärslokaler, fastighetskapitalfonder, fastighetsfonder eller aktier i bolag som bedriver fastighetsplaceringsverksamhet i Finland.

Kapitalplaceringar

Kapitalplaceringarna görs i kapitalfonder som placerar i aktier i onoterade bolag eller i lånefinansiering i dessa bolag.

Välj den lämpligaste portföljen bland tre olika alternativ

Vi hjälper dig att från tre olika alternativ välja en portfölj som motsvarar ditt placeringsmål och din risktolerans: Omfattande Måttlig, Omfattande Jämvikt och Omfattande Modig. Vikterna för aktie-, ränte-, fastighets- och kapitalplaceringarna i portföljerna varierar enligt portföljens risknivå.

När du har valt en portfölj med önskad risknivå, fattar en specialist inom egendomsförvaltning beslut om placeringsobjekten och allokeringen av dina besparingar för din räkning inom de överenskomna gränserna.

Bekanta dig med placeringsportföljer och deras värdeutveckling.

Så här drar du nytta av placeringsportföljer med omfattande diversifiering

Vi är en av Finlands mest erfarna kapitalförvaltare. Placering har alltid varit en viktig del av vår försäkringsverksamhet, dvs. så länge som LokalTapiola har försäkrat har vi också placerat. Som kund i ett ömsesidigt bolag är du en av våra ägare och vi vill ställa vår erfarenhet och kompetens till ditt förfogande. Vi tillhandahåller professionell och ansvarsfull kapitalförvaltning för alla placeringsbelopp.

Hos oss kan du placera i objekt som vanligtvis är tillgängliga endast för en stor placerare. Utöver aktier och räntor används fastighets- och kapitalplaceringar som placeringsobjekt – precis som vid placering av försäkringsbolagens medel. Du drar också nytta av prissättningen för en stor placerare.

Vi ser på din livssituation på ett övergripande sätt. Utöver heltäckande försäkringstjänster erbjuder vi även finansiella tjänster. Vi hjälper dig att förbereda dig för framtiden genom att försäkra, lyckas genom att placera och lägga undan för framtiden.

Du kan spara och placera i samma placeringsobjekt som vi använder när vi placerar LokalTapiolas tillgångar. Vi förvaltar dina placeringar lika omsorgsfullt och ansvarsfullt som vi gör med LokalTapiolas tillgångar.

En ansvarsfull placerare tar hänsyn till faktorerna som gäller miljö, socialt ansvar och god förvaltning när hen fattar placeringsbeslut. LokalTapiola Kapitalförvaltning har varit en föregångare inom ansvarsfulla placeringar i Finland och har under årens lopp systematiskt utvecklat sina verksamhetsmodeller för att möta de ökande utmaningarna inom ansvarsfullhet och hållbar utveckling samt den växande kundefterfrågan.

Hos oss kan du börja spara med så lite som 30 euro per månad eller så kan du placera ett större belopp på en gång. När det gäller sparande har du tiden på din sida, och med tiden kan även ett litet månadssparande bära frukt.

Läs mer

Produktfakta och villkor för placeringsförsäkring

Produktfakta (pdf)
Villkor (pdf)

Stadgar för placeringsportföljer med omfattande diversifiering

Omfattande Måttlig (pdf)
Omfattande Jämvikt (pdf)
Omfattande Modig (pdf)

Faktablad

Faktablad som gäller placeringsförsäkringar och placeringsobjekt

Vilka är de totala kostnaderna?

Totalkostnaderna består av den årliga förvaltningsprovisionen för försäkringen och kostnader som hänför sig till placeringsobjektet. Uppskattningar på de totala årliga kostnaderna presenteras nedan.

  • Omfattande Måttlig 1,45 %

  • Omfattande Jämvikt 1,65 %

  • Omfattande Modig 1,80 %

(Uppskattningen utgår från att tillgångarna som placerats i försäkringen är högst 100 000 euro, varvid förvaltningsprovisionen för försäkringen är 0,5 %. De totala kostnaderna inkluderar inte handelskostnader.)

Den årliga förvaltningsprovisionen för försäkringen varierar mellan 0,5 och 0,2 procent beroende på sparbeloppet:

  • 0,5 % upp till 100 000 EUR

  • 0,3 % för belopp över 100 000 EUR

  • 0,2 % för belopp över 2 000 000 EUR.

Kostnaderna för placeringsobjektet består av den fasta förvaltningsprovisionen för placeringsportföljen och övriga kostnader som hänför sig till placeringsobjekten i placeringsportföljen. Övriga kostnader är förvaringsavgifter, tecknings-, inlösen- och förvaltningsprovisioner, handelskostnader samt eventuella skatter och andra offentligrättsliga avgifter.

Vad kostar det att ta ut tillgångar från avtalet?

Du kan när som helst under avtalstiden ta ut sparbelopp från ditt avtal. Vid återköp och uttag av sparbelopp som gäller placeringsportföljen eller överföring av sparbelopp från placeringsportföljen till andra placeringsobjekt i försäkringen uppbärs en uttagsavgift på 1 % från beloppet som tas ut eller överförs. Från och med det tredje uttaget av sparbelopp, debiterar vi en handläggningsavgift på 27,65 euro (år 2022). För uppsägning av avtal debiteras inga avgifter. Beakta dock, att efter ett delvist uttag måste sparbeloppet uppgå till minst 150 euro.

Avkastningsförväntningarna på placeringsportföljer med omfattande diversifiering är efter de totala kostnaderna:

  • Omfattande Måttlig 1,8 %

  • Omfattande Jämvikt 3,1 %

  • Omfattande Modig 4,1 %

Tjänsteleverantörer

Placeringsförsäkringarna och kapitaliseringsavtalen tillhandahålls av LokalTapiola Ömsesidigt Livförsäkringsbolag och egendomsförvaltningen av LokalTapiola Kapitalförvaltning Ab.

LokalTapiola ansvarar inte för utvecklingen av värdet på placeringarna eller för en eventuell värdeminskning. Du bär som försäkringstagare risken för placeringarnas värdeutveckling och du kan också förlora det placerade kapitalet helt eller delvis. Observera att även om placeringsportföljerna innehåller samma objekt som LokalTapiola använder, så kan avkastningen på den portfölj du valt inte direkt jämföras med LokalTapiolas avkastning från placeringsverksamheten.

Den förväntade avkastningen är en uppskattning som utgår från avkastningsutvecklingen på lång sikt. Tidigare avkastning är ingen garanti för framtida avkastning.